Primary Antibodies

Jump to Filters
View as table Download
AMSH (STAMBP) (C-term) Rabbit Polyclonal Antibody
AP54063PU-N

USD 580.00

2 Weeks

AMSH (STAMBP) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 362-391 amino acids from the C-terminal region of Human STAMBP
AMSH (STAMBP) Rabbit Polyclonal Antibody
TA322496

USD 380.00

In Stock

Anti-STAMBP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 252-361 amino acids of human STAM binding protein
AMSH (STAMBP) Rabbit Polyclonal Antibody
TA322497

USD 380.00

In Stock

Anti-STAMBP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 252-361 amino acids of human STAM binding protein
AMSH (STAMBP) Rabbit Polyclonal Antibody
TA337635

USD 539.00

5 Days

Rabbit Polyclonal Anti-STAMBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAMBP antibody: synthetic peptide directed towards the N terminal of human STAMBP. Synthetic peptide located within the following region: SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
AMSH (STAMBP) Rabbit Polyclonal Antibody
TA357124

USD 539.00

5 Days

STAMBP Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
AMSH (STAMBP) Rabbit Polyclonal Antibody
TA363623

USD 539.00

5 Days

STAMBP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human STAMBP