Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal GSTM1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1. |
GSTM1 (1-159) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 159 of Human GSTM1 |
Rabbit Polyclonal Anti-GSTM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the N terminal of human GSTM1. Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI |
Rabbit Polyclonal Anti-GSTM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the C terminal of human GSTM1. Synthetic peptide located within the following region: PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
Active filters
Category
- Antibodies
Target Symbol
- GSTM1
Antibody Hosts
- Rabbit
Pathways
- Glutathione metabolism