Rabbit Polyclonal DEC1 Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DEC1 antibody maps to a region between residues 350 and the C-terminus (residue 412) of human Differentially Expressed in Chondrocytes NP_003661.1 (GeneID 8553). |
Rabbit Polyclonal Anti-BHLHB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHLHB2 antibody: synthetic peptide directed towards the middle region of human BHLHB2. Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE |
Rabbit polyclonal antibody to SHARP2 (basic helix-loop-helix domain containing, class B, 2)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 81 of SHARP2 (Uniprot ID#O14503) |
SHARP2 (BHLHE40) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 29-59 amino acids from the N-terminal region of human BHLHE40 |
Germany
Japan
United Kingdom
China
