Primary Antibodies

Jump to Filters
View as table Download
ATP5PD Rabbit Polyclonal Antibody
TA340103

USD 539.00

5 Days

Rabbit Polyclonal Anti-ATP5H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP5H antibody: synthetic peptide directed towards the C terminal of human ATP5H. Synthetic peptide located within the following region: CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY
ATP5PD Rabbit Polyclonal Antibody
TA315059

USD 380.00

In Stock

Rabbit polyclonal anti-ATP5H antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of humanATP5H.