Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against Carbonic Anhydrase IX

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen A synthetic peptide derived from a C-terminal sequence of the human CA IX.

Anti-CA4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4

Anti-CA4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4

Rabbit polyclonal anti-CA14 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA14.

Anti-CA14 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV
TA322419 is a possible alternative to TA322418.

Rabbit Polyclonal Anti-CA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA4 antibody: synthetic peptide directed towards the middle region of human CA4. Synthetic peptide located within the following region: DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF

Rabbit Polyclonal Anti-CA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA4 antibody: synthetic peptide directed towards the C terminal of human CA4. Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG

Rabbit Polyclonal Carbonic Anhydrase IX Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N Terminus Region