Primary Antibodies

Jump to Filters
View as table Download
FOXP3 Rabbit Polyclonal Antibody
TA336306

USD 620.00

5 Days

Rabbit Polyclonal FoxP3 Antibody

Applications FC, ICC/IF, IHC, Immunoblotting, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A peptide corresponding to amino acids 43-100 of mouse FOXP3. [Swiss-Prot# Q99JB6]
FOXP3 Rabbit Polyclonal Antibody
TA331137

USD 485.00

5 Days

Rabbit Polyclonal Anti-FOXP3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3. Synthetic peptide located within the following region: PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGL
FOXP3 Rabbit Polyclonal Antibody
TA321829

USD 380.00

In Stock

Anti-FOXP3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 410-424 amino acids of Human forkhead box P3
FOXP3 Rabbit Polyclonal Antibody
TA301515

USD 550.00

5 Days

Rabbit Polyclonal Antibody against FOXP3

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human FOXP3 (between residues 1-50).
FOXP3 Rabbit Polyclonal Antibody
TA354703

USD 395.00

5 Days

Rabbit anti FOXP3 Polyclonal Antibody

Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human FOXP3 protein. This sequence is identical within human, mouse, rat origins.