Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit Polyclonal Anti-PTGER3 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | PTGER3 / EP3 antibody was raised against synthetic 17 amino acid peptide from 1st cytoplasmic domain of human PTGER3 / EP3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bat (100%); Mouse (94%); Xenopus (88%); Bovine, Pig, Opossum (82%). |
Rabbit polyclonal GR (Ab-226) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 226/234/246 (L-L-S-P-L). |
Rabbit polyclonal NR3C1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This NR3C1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-262 amino acids from the Central region of human NR3C1. |
Rabbit polyclonal Thyroid Hormone Receptor Beta antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Thyroid Hormone Receptor β antibody. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Thrb Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL |
Rabbit polyclonal GR (Ser203) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 203 (S-G-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal GR (Ser211) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-SP-P-W). |
| Modifications | Phospho-specific |
Rabbit polyclonal Thyroid Hormone Receptor beta 1 antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-TR β1 antibody is affinity purified from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminal of human THRB isoform 1 protein. |
Rabbit polyclonal GR (Ab-203) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 203 (S-G-SP-P-G). |
Germany
Japan
United Kingdom
China
