Primary Antibodies

Jump to Filters
View as table Download
Plasminogen (PLG) Rabbit Polyclonal Antibody
AP21382BT-N

USD 540.00

2 Weeks

Plasminogen (PLG) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Plasminogen isolated and purified from human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Leptin (LEP) (N-term) Rabbit Polyclonal Antibody
AP52465PU-N

USD 580.00

2 Weeks

Leptin (LEP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 7-37 amino acids from the N-terminal region of Human Leptin.
Luteinizing Hormone beta (LHB) Rabbit Polyclonal Antibody
TA323537

USD 380.00

4 Weeks

Anti-LHB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 114-128 amino acids of Human luteinizing hormone beta polypeptide
hCG (CGA) Rabbit Polyclonal Antibody
TA349798

USD 380.00

In Stock

Rabbit Polyclonal Anti-CGA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CGA
GH2 Rabbit Polyclonal Antibody
TA350016

USD 380.00

In Stock

Rabbit Polyclonal Anti-GH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GH2
Plasminogen (PLG) Rabbit Polyclonal Antibody
TA351544

USD 380.00

In Stock

Rabbit Polyclonal Anti-PLG Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLG
Leptin (LEP) Rabbit Polyclonal Antibody
TA328367

USD 314.00

In Stock

Anti-Human Leptin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Leptin
Growth Hormone (GH1) Rabbit Polyclonal Antibody
TA351214

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GH1
Luteinizing Hormone beta (LHB) Rabbit Polyclonal Antibody
AP02115SU-S

USD 175.00

2 Weeks

Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum

Applications ELISA, IHC, R, WB
Reactivities Bovine, Deer, Goat, Human, Sheep
Conjugation Unconjugated
Immunogen Bovine Luteinizing Hormone
Prothrombin (F2) Rabbit Polyclonal Antibody
TA346200

USD 539.00

5 Days

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
Prothrombin (F2) Rabbit Polyclonal Antibody
TA351802

USD 380.00

In Stock

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2
GABA B Receptor 1 (GABBR1) Rabbit Polyclonal Antibody
TA313903

USD 380.00

In Stock

Rabbit polyclonal GABA B Receptor antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GABA B receptor.
Leptin (LEP) Rabbit Polyclonal Antibody
TA328366

USD 314.00

In Stock

Biotinylated Anti-Human Leptin Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Biotin
Immunogen E.coli derived Recombinant Human Leptin
Trypsin (PRSS3) (Center) Rabbit Polyclonal Antibody
AP53469PU-N

USD 580.00

2 Weeks

Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3
Trypsin (PRSS3) (N-term) Rabbit Polyclonal Antibody
AP53470PU-N

USD 580.00

2 Weeks

Trypsin (PRSS3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 20-48aa) of human Trypsin-3 / PRSS3