Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-TGF beta2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β2. |
Rabbit polyclonal anti-TGFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TGFB2 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-Tgfb1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV |
Rabbit polyclonal anti-TGF beta3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit Polyclonal Anti-TGF beta1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit anti TGF-beta 2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein. |
Rabbit anti TGF beta Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human TGF-beta protein. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Families
- Secreted Protein
Pathways
- Chronic myeloid leukemia