Primary Antibodies

Jump to Filters
View as table Download
CYB5R3 Rabbit Polyclonal Antibody
AP20483PU-N

USD 465.00

3 Weeks

CYB5R3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CYB5R3 Rabbit Polyclonal Antibody
TA890109

USD 407.00

In Stock

Rabbit Polyclonal anti-CYB5R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CYB5R3
CYB5R3 Rabbit Polyclonal Antibody
TA311774

USD 380.00

4 Weeks

Rabbit polyclonal anti-CYB5R3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYB5R3.
Modifications Phospho-specific
CYB5R3 Rabbit Polyclonal Antibody
TA343075

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYB5R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYB5R3 antibody: synthetic peptide directed towards the C terminal of human CYB5R3. Synthetic peptide located within the following region: IRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD