Primary Antibodies

Jump to Filters
View as table Download
Metabotropic Glutamate Receptor 1 (GRM1) Rabbit Polyclonal Antibody
TA321218

USD 380.00

In Stock

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1
HTR2C Rabbit Polyclonal Antibody
TA313299

USD 380.00

In Stock

Rabbit polyclonal anti-5-HT-2C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C.
beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody
TA329147

USD 485.00

In Stock

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
HTR2C Rabbit Polyclonal Antibody
TA350954

USD 380.00

In Stock

Rabbit Polyclonal Anti-HTR2C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR2C
Metabotropic Glutamate Receptor 5 (GRM5) Rabbit Polyclonal Antibody
TA890123

USD 407.00

In Stock

Rabbit Polyclonal anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM5