Primary Antibodies

Jump to Filters
View as table Download
Proteasome 20S alpha 5 (PSMA5) Rabbit Polyclonal Antibody
TA332887

USD 365.00

3 Weeks

Rabbit anti-PSMA5 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMA5
Proteasome 20S alpha 5 (PSMA5) Rabbit Polyclonal Antibody
TA342161

USD 539.00

5 Days

Rabbit polyclonal Anti-PSMA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the N terminal of human PSMA5. Synthetic peptide located within the following region: MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV
Proteasome 20S alpha 5 (PSMA5) Rabbit Polyclonal Antibody
TA342162

USD 539.00

5 Days

Rabbit polyclonal Anti-PSMA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the middle region of human PSMA5. Synthetic peptide located within the following region: FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK