Primary Antibodies

Jump to Filters
View as table Download
DFFB (N-term) Rabbit Polyclonal Antibody
AP51245PU-N

USD 580.00

2 Weeks

DFFB (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human DFFB / CAD.
DFFB Rabbit Polyclonal Antibody
TA340051

USD 539.00

5 Days

Rabbit Polyclonal Anti-DFFB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DFFB antibody: synthetic peptide directed towards the middle region of human DFFB. Synthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK