Primary Antibodies

Jump to Filters
View as table Download
ARHGEF1 Rabbit Polyclonal Antibody
TA314863

USD 380.00

4 Weeks

Rabbit polyclonal anti-ARHGEF1 antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1.
ARHGEF1 Rabbit Polyclonal Antibody
TA343288

USD 539.00

5 Days

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG