Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Anti-PAK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 225-238 amino acids of Human p21 protein (Cdc42/Rac)-activated kinase |
TA323823 is a possible alternative to TA323824.
Rabbit polyclonal PAK1 (Ab-204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1 around the phosphorylation site of serine 204 (T-R-SP-V-I). |
Rabbit polyclonal PAK1 (Phospho-Ser199) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y). |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK1/2 (Ab-199) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2 around the phosphorylation site of serine 199 (T-K-SP-V-Y). |
Rabbit Polyclonal Anti-PFN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL |
Rabbit polyclonal PAK1/2/3 (Ab-423/402/421) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1/2/3 around the phosphorylation site of threonine 423/402/421 (R-S-TP-M-V). |
Anti-PFN1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1 |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Stem cell - Pluripotency
Pathways
- Regulation of actin cytoskeleton