Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Xenopus, Chicken, Bovine, Rhesus Monkey, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB). |
Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC |
PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit. |
Rabbit Polyclonal Anti-PPP1CB Antibody
| Applications | WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP |
Rabbit Polyclonal Anti-PPP1CB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: VPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLI |
Active filters
Reactivities
- Human
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Phosphatase
Pathways
- Vascular smooth muscle contraction