Rabbit Polyclonal Anti-RARG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARG antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: SPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPR |
Rabbit Polyclonal Anti-RARG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the middle region of human RARG. Synthetic peptide located within the following region: QYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITK |
Rabbit Polyclonal Anti-RARG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RARG Antibody: synthetic peptide directed towards the N terminal of human RARG. Synthetic peptide located within the following region: YPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTS |
Germany
Japan
United Kingdom
China