Primary Antibodies

Jump to Filters
View as table Download
KCNMA1 Rabbit Polyclonal Antibody
TA338525

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
KCNMA1 Rabbit Polyclonal Antibody
AP20653PU-N

USD 445.00

3 Weeks

KCNMA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 750-800 of Human MaxiKα
KCNMA1 Rabbit Polyclonal Antibody
TA331455

USD 539.00

5 Days

Rabbit polyclonal Anti-KCNMA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the middle region of human KCNMA1. Synthetic peptide located within the following region: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD