Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DBT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DBT antibody is: synthetic peptide directed towards the N-terminal region of Human DBT. Synthetic peptide located within the following region: EWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVG

Rabbit Polyclonal Anti-DBT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBT antibody: synthetic peptide directed towards the N terminal of human DBT. Synthetic peptide located within the following region: NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW