Rabbit Polyclonal Cytokeratin 19 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the C-terminal region of human Cytokeratin 19 (between residues 350-400) [UniProt P08727] |
Rabbit Polyclonal Cytokeratin 19 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal portion of the human Cytokeratin 19 protein (between residues 1-50) [UniProt P08727] |
Rabbit Polyclonal Anti-KRT19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR |
Rabbit Polyclonal Anti-Keratin 19 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 19 Antibody: A synthesized peptide derived from human Keratin 19 |
Germany
Japan
United Kingdom
China
