Primary Antibodies

Jump to Filters
View as table Download
GPR34 Rabbit Polyclonal Antibody
TA313952

USD 380.00

2 Weeks

Rabbit polyclonal anti-GPR34 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR34.
GPR34 (Center) Rabbit Polyclonal Antibody
AP51926PU-N

USD 580.00

2 Weeks

GPR34 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 239-269aa) of human GPR34.
GPR34 Rabbit Polyclonal Antibody
TA338155

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: SFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLH
GPR34 Rabbit Polyclonal Antibody
TA338154

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: KGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNL