Primary Antibodies

Jump to Filters
View as table Download
myosin heavy chain 9 (MYH9) Rabbit Polyclonal Antibody
TA346515

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYH9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK