Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ALF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV

Rabbit Polyclonal Anti-ALF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV

Rabbit Polyclonal Anti-GTF2A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: GSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNS

Rabbit Polyclonal Anti-GTF2A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD

Rabbit Polyclonal Anti-GTF2A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2A1L antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE