Primary Antibodies

View as table Download

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP