Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit polyclonal KLF5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This KLF5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 341-370 amino acids from the C-terminal region of human KLF5. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal SOX4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 86-114 amino acids from the N-terminal region of human SOX4. |
Rabbit Polyclonal Anti-SOX4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX4 Antibody: synthetic peptide directed towards the N terminal of human SOX4. Synthetic peptide located within the following region: MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPS |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Antibody against NANOG (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 94-123 amino acids from the Central region of human NANOG. |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Induced pluripotent stem cells
Filter by
Category
Target Symbol
- C-MYC (8)
- EGF (8)
- SOX2 (7)
- BDNF (6)
- OCT4 (5)
- KLF4 (4)
- SOX4 (4)
- TCF3 / E2A (4)
- BMP7 (3)
- CD38 (3)
- FGF4 (3)
- NANOG (3)
- PDX1 (3)
- WNT3A (3)
- AXIN 2 (2)
- BMP2 (2)
- BMP4 (2)
- BMP6 (2)
- CD4 (2)
- DNMT3B (2)
- DPPA2 (2)
- FOXA2 (2)
- GATA4 (2)
- SOX11 (2)
- SOX9 (2)
- WNT8A (2)
- BMP5 (1)
- BMP8B (1)
- GDF3 (1)
- KLF5 (1)
- OTX2 (1)
- SOX10 (1)
- SOX7 (1)
- UTF1 (1)
Reactivities
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (30)
- MAPK signaling pathway (25)
- TGF-beta signaling pathway (19)
- Endometrial cancer (18)
- Bladder cancer (16)
- ErbB signaling pathway (16)
- Hedgehog signaling pathway (16)
- Wnt signaling pathway (15)
- Cytokine-cytokine receptor interaction (13)
- Basal cell carcinoma (11)
- Melanoma (11)
- Regulation of actin cytoskeleton (11)
- Acute myeloid leukemia (10)
- Colorectal cancer (10)
- Endocytosis (10)
- Cell cycle (8)
- Chronic myeloid leukemia (8)
- Focal adhesion (8)
- Gap junction (8)
- Glioma (8)
- Jak-STAT signaling pathway (8)
- Non-small cell lung cancer (8)
- Pancreatic cancer (8)
- Prostate cancer (8)
- Small cell lung cancer (8)
- Thyroid cancer (8)
- Hematopoietic cell lineage (7)
- Melanogenesis (7)
- Huntington's disease (6)
- Neurotrophin signaling pathway (6)
- Maturity onset diabetes of the young (5)
- Metabolic pathways (5)
- Calcium signaling pathway (3)
- Nicotinate and nicotinamide metabolism (3)
- Type II diabetes mellitus (3)
- Antigen processing and presentation (2)
- Cell adhesion molecules (CAMs) (2)
- Cysteine and methionine metabolism (2)
- Primary immunodeficiency (2)
- T cell receptor signaling pathway (2)