Rabbit Polyclonal beta-Actin Antibody
| Applications | Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
Anti-SRC Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 270-523 amino acids of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) |
Anti-SRC Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 270-523 amino acids of human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
Rabbit polyclonal AKT pS473 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to the C-terminus aa 460-480 of human, mouse, rat and chicken AKT proteins conjugated to KLH. |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Anti-AKT3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 450-468 amino acids of human v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) |
Germany
Japan
United Kingdom
China
