Primary Antibodies

View as table Download

Rabbit polyclonal Rab5 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Rab5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human Rab5.

Rabbit polyclonal Anti-RAB5A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS

Rabbit anti-RAB5A Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAB5A