Primary Antibodies

View as table Download

Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M).
Modifications Phospho-specific

Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)

Applications IHC
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%).

Rabbit Polyclonal Anti-ADCY3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ADCY3

Rabbit Polyclonal Anti-PRKG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKG2

CAMK2A rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CaMKII around the phosphorylation site of Threonine 286 (Q-E-Tp-V-D).

CAMK2A rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CaMKII around the phosphorylation site of Threonine 286 (Q-E-Tp-V-D).

cGKI (PRKG1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated

Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E).
Modifications Phospho-specific

Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C).
Modifications Phospho-specific

Rabbit Polyclonal beta-Arrestin 2 Antibody

Applications IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1.

Rabbit polyclonal PKA CAT (Ab-197) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C).

CAMK2G (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 309-338 amino acids from the C-terminal region of Human CAMK2G (CAMK2 gamma).

OR9Q1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 282-312 amino acids from the C-terminal region of human Olfactory receptor 9Q1

Rabbit Polyclonal Anti-ARRB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL

CAMK2A pThr286 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat, Xenopus
Conjugation Unconjugated
Immunogen Phosphopeptide corresponding to amino acid residues surrounding the phosphoThr286 found in Rat brain CaM Kinase II.