Primary Antibodies

Jump to Filters
View as table Download
PXR (NR1I2) Rabbit Polyclonal Antibody
TA339539

USD 539.00

5 Days

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDA
PXR (NR1I2) (Center) Rabbit Polyclonal Antibody
AP18142PU-N

USD 580.00

2 Weeks

PXR (NR1I2) (Center) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 100-127 aa selected from the Center region of human NR1I2