Primary Antibodies

Jump to Filters
View as table Download
DLX5 Rabbit Polyclonal Antibody
TA312202

USD 380.00

In Stock

Rabbit polyclonal anti-DLX5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DLX5.
DLX5 Rabbit Polyclonal Antibody
AP20392PU-N

USD 465.00

3 Weeks

DLX5 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
DLX5 Rabbit Polyclonal Antibody
TA332068

USD 539.00

5 Days

Rabbit Polyclonal Anti-DLX5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DLX5 Antibody: synthetic peptide directed towards the middle region of human DLX5. Synthetic peptide located within the following region: KEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAE
DLX5 Rabbit Polyclonal Antibody
TA343518

USD 485.00

5 Days

Rabbit Polyclonal Anti-DLX5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX5 antibody: synthetic peptide directed towards the C terminal of human DLX5. Synthetic peptide located within the following region: HPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY