Rabbit Polyclonal Anti-GPD2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPD2 |
Rabbit Polyclonal Anti-GPD2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPD2 |
Rabbit Polyclonal GPAT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPAT1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of the human GPAT1. The immunogen is located within amino acids 730 - 780 of GPAT1. |
Rabbit Polyclonal Anti-ACHE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACHE |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Rabbit Polyclonal Anti-GPAM Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPAM |
GPD1L (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 47-77 amino acids from the N-terminal region of human GPD1L |
Anti-AGPAT4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 146-306 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 4 |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Rabbit Polyclonal Anti-DGKZ Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DGKZ |
Rabbit Polyclonal Anti-DGKB Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DGKB |
USD 380.00
In Stock
Rabbit Polyclonal Anti-PLA2G6 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PLA2G6 |
Rabbit Polyclonal Anti-GNPAT Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GNPAT |
USD 580.00
2 Weeks
Glycerol 3 Phosphate Dehydrogenase (GPD1) (N-term) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 35~65 amino acids from the N-terminal region of Human GPD1 |
Rabbit polyclonal PCYT1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Hamster) |
Conjugation | Unconjugated |
Immunogen | This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A. |
Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV |