Id3 (NM_008321) Mouse Recombinant Protein

CAT#: TP527292

Purified recombinant protein of Mouse inhibitor of DNA binding 3 (Id3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227292 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSTEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL
  QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 13.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032347
• Locus ID: 15903
• UniProt ID: P41133, Q545W1
• Cytogenetics: 4 68.34 cM
• Refseq Size: 964
• Refseq ORF: 360
• Synonyms: bHLHb25; Hlh462; Idb3
• Summary: Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.[UniProtKB/Swiss-Prot Function]