Tbx20 (NM_194263) Mouse Recombinant Protein

CAT#: TP527271

Purified recombinant protein of Mouse T-box 20 (Tbx20), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
TBX20 Antibody - middle region
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Tbx20"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR227271 representing NM_194263
Red=Cloning site Green=Tags(s)

MEFTASPKPQLSSRANAFSIAALMSSGGPKEKEAAENTIKPLEQFVEKSSCAQPLGELTSLDAHAEFGGG
GGSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVD
PESKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNN
ELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNP
FAKGFRDSSRLTDIERESVESLIQKHSYARSPIRTYGEEDVLGEESQTTQSRGSAFTTSDNLSLSSWVSS
SSSFPGFQHPQPLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHMPRYH
HYFQQGPYAAIQGLRHSSAVMTPFV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 49.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_919239
Locus ID 57246
UniProt ID Q9ES03
Cytogenetics 9 A4
Refseq Size 6436
Refseq ORF 1335
Synonyms 9430010M06Rik; AL022859; Tbx12
Summary Acts as a transcriptional activator and repressor required for cardiac development and may have key roles in the maintenance of functional and structural phenotypes in adult heart.[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.