Bub1 (NM_001113179) Mouse Recombinant Protein

CAT#: TP526889

Purified recombinant protein of Mouse BUB1, mitotic checkpoint serine/threonine kinase (Bub1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226889 representing NM_001113179
  Red=Cloning site Green=Tags(s)
  
  MDNLENVFRMFEAHMQSYTGNDPLGEWESFIKWVEENFPDNKEYLMTLLEHLMKEFLHKKNYHNDSRFIN
  YCLKFAEYNSDRHQFFEFLYNQGIGTKSSYIYMSWAGHLEAQGELQHASAIFQTGIHNEAEPKELLQQQY
  RLFQARLTGIHLPAQATTSEPLHSAQILNQVMMTNSSPEKNSACVPRSQGSECSGVASSTCDEKSNIREQ
  RVIMISKSECSVSSSVAPKPEAQQVMYCKEKLIRGDSEFSFEELRAQKYNQRKKHEQWVSEDRNYMKRKE
  ANAFEEQLLKQKMDELHKKLHQVVELSHKDLPASENRPDVSLVCVGQNTCSQQELRGPSLSSISHQTSES
  SGEKPQEEPSVPLMVNAVNSTLLFPAANLPALPVPVSGQSLTDSRCVNQSVHEFMPQCGPETKEVCETNK
  VASINDFHTTPNTSLGMVQGTPCKVQPSPTVHTKEALGFIMDMFQAPTLPDISDDKDEWPSLDQNEDAFE
  AQFQKNAVSSGDWGVKKIMTLSSAFPIFEDGNKENYGLPQPKNKPLGARTFGERSLSKYSSRSNEMPHTD
  EFMDDSTVCGIRCNKTLAPSPKSIGDFTSAAQLSSTPFHKFPADLVQIPEDKENVVATQYTHMALDSCKE
  NIVDLSKGRKLGPIQEKISASLPCPSQPATGGLFTQEAVFGLEAFKCTGIDHATVEDLSDANAGLQVECV
  QTLGNVNAPSFTVENPWDDELILKLLSGLSKPVTSYSNTFEWQSKLPAIKTKTEYQLGSLLVYVNHLLGE
  GAFAQVFEAIHGDVRNAKSEQKCILKVQRPANSWEFYIGMQLMERLKPEVHHMFIKFYSAHLFKNGSILV
  GELYSYGTLLNVINLYKNTSEKVMPQALVLTFAIRMLYMVEQVHSCEIIHGDIKPDNFILGHRFLEQADE
  DLATGLALIDLGQSIDMKLFPKGTVFTGKCETSGFQCPEMLSNKPWNYQIDYFGVAATIYCMLFGSYMKV
  KNEGGVWKPEGLFRRLPHLDMWEEFFHIMLNIPDCHNLPSLDFLRQNMKKLLEQQYSNKIKTLRNRLIVM
  LSEYKRSRK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 120.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001106650
• Locus ID: 12235
• UniProt ID: O08901, Q8K1K8, A2APR8
• Cytogenetics: 2 62.1 cM
• Refseq Size: 4337
• Refseq ORF: 3177
• Synonyms: AL022991; Bub1a; C80208; D2Xrf87
• Summary: Serine/threonine-protein kinase that performs 2 crucial functions during mitosis: it is essential for spindle-assembly checkpoint signaling and for correct chromosome alignment. Has a key role in the assembly of checkpoint proteins at the kinetochore, being required for the subsequent localization of CENPF, BUB1B, CENPE and MAD2L1. Required for the kinetochore localization of PLK1. Required for centromeric enrichment of AUKRB in prometaphase. Plays an important role in defining SGO1 localization and thereby affects sister chromatid cohesion. Acts as a substrate for anaphase-promoting complex or cyclosome (APC/C) in complex with its activator CDH1 (APC/C-Cdh1). Necessary for ensuring proper chromosome segregation and binding to BUB3 is essential for this function. Can regulate chromosome segregation in a kinetochore-independent manner. Can phosphorylate BUB3. The BUB1-BUB3 complex plays a role in the inhibition of APC/C when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20. This complex can also phosphorylate MAD1L1. Kinase activity is essential for inhibition of APC/CCDC20 and for chromosome alignment but does not play a major role in the spindle-assembly checkpoint activity. Mediates cell death in response to chromosome missegregation and acts to suppress spontaneous tumorigenesis. Essential during early and later stages of embryonic development. Necessary for postimplantation embryogenesis and proliferation of primary embryonic fibroblasts and plays an important role in spermatogenesis and fertility.[UniProtKB/Swiss-Prot Function]