Cd69 (NM_001033122) Mouse Recombinant Protein

CAT#: TP526790

Purified recombinant protein of Mouse CD69 antigen (Cd69), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226790 representing NM_001033122
  Red=Cloning site Green=Tags(s)
  
  MDSENCSITENSSSHLERGQKDHGTSIHFEKHHEGSIQVSIPWAVLIVVLITSLIIALIALNVGKYNCPG
  LYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELE
  HWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 23 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001028294
• Locus ID: 12515
• UniProt ID: P37217, Q3U6A8
• Cytogenetics: 6 63.21 cM
• Refseq Size: 1620
• Refseq ORF: 597
• Synonyms: 5830438K24Rik; AI452015; AIM; VEA
• Summary: Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.[UniProtKB/Swiss-Prot Function]