Lta (NM_010735) Mouse Recombinant Protein

CAT#: TP526758

Purified recombinant protein of Mouse lymphotoxin A (Lta), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Lta was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226758 representing NM_010735
  Red=Cloning site Green=Tags(s)
  
  MTLLGRLHLLRVLGTPPVFLLGLLLALPLGAQGLSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSK
  QNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYP
  FHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034865
• Locus ID: 16992
• UniProt ID: P09225, Q542S2
• Cytogenetics: 17 18.59 cM
• Refseq Size: 1423
• Refseq ORF: 606
• Synonyms: hlb382; LT; LT-alpha; LT-[a]; LTalpha; Ltx; LT[a]; TNF-beta; Tnfb; TNFSF1; Tnfsf1b; Tnlg1e
• Summary: Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM (By similarity). In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.[UniProtKB/Swiss-Prot Function]