Ifngr1 (NM_010511) Mouse Recombinant Protein

CAT#: TP526594

Purified recombinant protein of Mouse interferon gamma receptor 1 (Ifngr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226594 representing NM_010511
  Red=Cloning site Green=Tags(s)
  
  MGPQAAAGRMILLVVLMLSAKVGSGALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTV
  QVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEI
  RRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCEL
  NISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDSIWILVVAPLTVFTVVILVFAYWYTKK
  NSFKRKSIMLPKSLLSVVKSATLETKPESKYSLVTPHQPAVLESETVICEEPLSTVTAPDSPEAAEQEEL
  SKETKALEAGGSTSAMTPDSPPTPTQRRSFSLLSSNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLP
  NNNSETKMAEHDPPPVRKAPMASGYDKPHMLVDVLVDVGGKESLMGYRLTGEAQELS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 52.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034641
• Locus ID: 15979
• UniProt ID: P15261
• Cytogenetics: 10 8.49 cM
• Refseq Size: 2099
• Refseq ORF: 1431
• Synonyms: CD119; Ifgr; IFN-gammaR; Ifngr; Nktar
• Summary: Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:2530582, PubMed:2532365, PubMed:2137461, PubMed:2531896, PubMed:2530216). Ligand binding stimulates activation of the JAK/STAT signaling pathway (By similarity).[UniProtKB/Swiss-Prot Function]