Elk4 (NM_007923) Mouse Recombinant Protein

CAT#: TP525575

Purified recombinant protein of Mouse ELK4, member of ETS oncogene family (Elk4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225575 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSAITLWQFLLQLLQEPQNEHMICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKN
  IIKKVNGQKFVYKFVSYPEILKMDPLTVGRIEGDCEALNSIETSSSKDVEYGGKERPPQPGAKTSSRNDY
  IHSGLYSSFTLNSLNTSNKKLFKSIKIENPAEKLAEKKAQEPTPSVIKFVTTPAKKPPIEPVAAAFATSP
  SLSPSSEETIQALETLVSPTLPSLETPASISILATTFNPTPPVPSTPLPLKEPPRTPSPPLSSNPDIDTD
  IESVASQPMELPENLSLEPKNEDSALPEKDKTNNSSRSKKPKGLELTPALVVTGSDPSPLGILSPSLPTA
  SLTPALFSQTPILLTPSPLLSSIHFWSTLSPFAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTP
  GPFSPDLQKT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 46.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031949
• Locus ID: 13714
• UniProt ID: P41158
• Cytogenetics: 1 E4
• Refseq Size: 3671
• Refseq ORF: 1293
• Synonyms: 2310011G17Rik; A130026I01Rik; BB162516; SAP-1; Sap1
• Summary: Involved in both transcriptional activation and repression. Interaction with SIRT7 leads to recruitment and stabilization of SIRT7 at promoters, followed by deacetylation of histone H3 at 'Lys-18' (H3K18Ac) and subsequent transcription repression. Forms a ternary complex with the serum response factor (SRF). Requires DNA-bound SRF for ternary complex formation and makes extensive DNA contacts to the 5'side of SRF, but does not bind DNA autonomously (By similarity).[UniProtKB/Swiss-Prot Function]