Mtdh (NM_026002) Mouse Recombinant Protein

CAT#: TP524759

Purified recombinant protein of Mouse metadherin (Mtdh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Mtdh was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR224759 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAARSWQDELAQQAEEGSARLRELLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYG
  WAAACAGARKKRRSPPRKREEAAPPTPAPDDLAQLKNLRSEEQKKKNRKKLPEKPKPNGRTVEVPEDEVV
  RNPRSITAKQAPETDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVL
  TDSGSLDSTIPGIENIITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSRLNENLTV
  NGGGWSEKSVKLSSQLSEEKWNSVPPASAGKRKTEPSAWTQDTGDTNANGKDWGRNWSDRSIFSGIGSTA
  EPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPSSDWNAPAEEWGNWVDEDRASLLKSQEPISNDQ
  KVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSHTQDTEDLEKDTREELPVNTSKARPKQEKACSLKTM
  STSDPAEVLIKNSQPVKTLPPAISAEPSITLSKGDSDNSSSQVPPMLQDTDKPKSNAKQNSVPPSQTKSE
  TNWESPKQIKKKKKARRET
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 63.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080278
• Locus ID: 67154
• UniProt ID: Q80WJ7
• Cytogenetics: 15 13.98 cM
• Refseq Size: 3680
• Refseq ORF: 1740
• Synonyms: 3D3; 3D3/Lyric; 2610103J23Rik; AEG-1; AV353288; D8Bwg1112e; Lyric
• Summary: Downregulates SLC1A2/EAAT2 promoter activity when expressed ectopically. Activates the nuclear factor kappa-B (NF-kappa-B) transcription factor. Promotes anchorage-independent growth of immortalized melanocytes and astrocytes which is a key component in tumor cell expansion. Promotes lung metastasis and also has an effect on bone and brain metastasis, possibly by enhancing the seeding of tumor cells to the target organ endothelium. Induces chemoresistance (By similarity).[UniProtKB/Swiss-Prot Function]