A1cf (NM_001081074) Mouse Recombinant Protein

CAT#: TP524176

Purified recombinant protein of Mouse APOBEC1 complementation factor (A1cf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR224176 representing NM_001081074
  Red=Cloning site Green=Tags(s)
  
  MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDSTPPERGCEIFIGKLPRDLFED
  ELIPLCEKIGKIYEMRLMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNYEIRTGRLLGVCASVDNCRLFV
  GGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRRLLPGRIQLWGHP
  IAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNSIKPGAVERVKKIRDYAFVHFSNREDAV
  EAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRNTMLQGEYTYPLSHVYDPTTTYLGAPVFYTP
  QAYAAIPSLHFPATKGHLSNRALIRTPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYHVKGDKRED
  KLYDLLPGMELTPMNTVSLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKVTIPALAS
  QNPAIHPFIPPKLSAYVDEAKRYAAEHTLQTLGIPTEGGDAGTTAPTATSATVFPGYAVPSATAPVSTAQ
  LKQAVTLGQDLAAYTTYEVYPTFALTTRGDAYGTF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 65.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001074543
• Locus ID: 69865
• UniProt ID: Q5YD48
• Cytogenetics: 19 C1
• Refseq Size: 3828
• Refseq ORF: 1785
• Synonyms: 1810073H04Rik; Acf; ACF64; ACF65; ASP; MCM; mer; MerCreMer; Tg(Myh6-cre/Esr1*)1Jmk
• Summary: Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also seems to protect the edited APOB mRNA from nonsense-mediated decay (By similarity).[UniProtKB/Swiss-Prot Function]