OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

P2rx2 (NM_153400) Mouse Recombinant Protein

Be the first to review this product
SKU
TP524157
Purified recombinant protein of Mouse purinergic receptor P2X, ligand-gated ion channel, 2 (P2rx2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA355769 P2rx2 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "P2rx2 or NM_153400"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224157 representing NM_153400
Red=Cloning site Green=Tags(s)

MAAAQPRLPAGAAMVRRLARGCWSAFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQD
SETXXPESSIITKVKGITMSEHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL
DDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGTSENHFLGKMAPNFTILIKNSIHYPKF
KFSKGNIASQKSDYLKHCTFDQDSDPYCPIFRLGFIVEQAGENFTELAHKGGVIGVIINWNCDLDLSESE
CNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLAT
ALTSIGVGSFLCDWILLTFMNKNKLYSHKKFDKVRTPRHPSSRWPVTLALVLGQIPPPPSHYSQDQPPSL
PSGEGPALGEGAELPLAVQPPRSCSSSALTEQVVDTLDQHMGQRPPVPEPSQQDSTSTDPKGLAQL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_700449
Locus ID 231602
UniProt ID Q8K3P1
Cytogenetics 5 F
RefSeq Size 1919
RefSeq ORF 1458
Synonyms P2x2; P2X2a
Summary Ion channel gated by extracellular ATP involved in a variety of cellular responses, such as excitatory postsynaptic responses in sensory neurons, neuromuscular junctions (NMJ) formation, hearing, perception of taste and peristalsis. In the inner ear, regulates sound transduction and auditory neurotransmission, outer hair cell electromotility, inner ear gap junctions, and K(+) recycling. Mediates synaptic transmission between neurons and from neurons to smooth muscle.UniProtKB/Swiss-Prot Function
Protein Categories Membrane Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products