P2rx2 (NM_153400) Mouse Recombinant Protein

CAT#: TP524157

Purified recombinant protein of Mouse purinergic receptor P2X, ligand-gated ion channel, 2 (P2rx2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR224157 representing NM_153400
  Red=Cloning site Green=Tags(s)
  
  MAAAQPRLPAGAAMVRRLARGCWSAFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQD
  SETXXPESSIITKVKGITMSEHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHL
  DDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGTSENHFLGKMAPNFTILIKNSIHYPKF
  KFSKGNIASQKSDYLKHCTFDQDSDPYCPIFRLGFIVEQAGENFTELAHKGGVIGVIINWNCDLDLSESE
  CNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLAT
  ALTSIGVGSFLCDWILLTFMNKNKLYSHKKFDKVRTPRHPSSRWPVTLALVLGQIPPPPSHYSQDQPPSL
  PSGEGPALGEGAELPLAVQPPRSCSSSALTEQVVDTLDQHMGQRPPVPEPSQQDSTSTDPKGLAQL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 54.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_700449
• Locus ID: 231602
• UniProt ID: Q8K3P1, Q812E7
• Cytogenetics: 5 F
• Refseq Size: 1919
• Refseq ORF: 1458
• Synonyms: P2x2; P2X2a
• Summary: Ion channel gated by extracellular ATP involved in a variety of cellular responses, such as excitatory postsynaptic responses in sensory neurons, neuromuscular junctions (NMJ) formation, hearing, perception of taste and peristalsis. In the inner ear, regulates sound transduction and auditory neurotransmission, outer hair cell electromotility, inner ear gap junctions, and K(+) recycling. Mediates synaptic transmission between neurons and from neurons to smooth muscle.[UniProtKB/Swiss-Prot Function]