Ube2c (NM_026785) Mouse Recombinant Protein

CAT#: TP523758

Purified recombinant protein of Mouse ubiquitin-conjugating enzyme E2C (Ube2c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR223758 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASQNRDPAAASVAAVRKGAEPCGGAARGPVGKRLQQELMILMTSGDKGISAFPESDNLFKWVGTIHGAA
  GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLG
  EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVSSQDP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 19.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081061
• Locus ID: 68612
• UniProt ID: Q9D1C1, A2A4Z0
• Cytogenetics: 2 85.27 cM
• Refseq Size: 931
• Refseq ORF: 540
• Synonyms: 1110015A16Rik; D2Ertd695e
• Summary: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.[UniProtKB/Swiss-Prot Function]