Baat1 (NM_172724) Mouse Recombinant Protein

CAT#: TP522786

Purified recombinant protein of Mouse BRCA1-associated ATM activator 1 (Baat1), transcript variant 1, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR222786 representing NM_172724
  Red=Cloning site Green=Tags(s)
  
  MDPECSRLLPALCAVLADPRQLVADDTCLEKLLDWFKTVTEAESSLQLLQDHPCLMELLSHVLKPQDVSP
  RVLSFALRLVGVFAAQEDCFEYLQQGELLLGLFGESGAPGWAAWSIPSVRSGWIQGLCYLAHHPSALHFL
  ADSGAVDTLFSLQGDPSLFVASAASQLLVHILALSMQGGAPGSPVPEAAAWPMCAQKIVNHVDESLHAKA
  TPQVTQALNVLTTTFGRCHNPWTGVLWERLSPPVARLFERDPIPAVHALMDLLLSVARSPVLNFAACGLW
  EMLAQTLSRLSPIQAGPLALGTLKLQHCPQELRTQAFGVLLQPLACILKATTQAPGPPGLLDGTVGSLLT
  VDILLASKSACVGLLCQTLAHLEELQMLPQCPSPWPQVHLLQAALTILHLCDGSADPSSSAGGRLCGTLG
  GCVRVQRAALDFLGTLSQGTSPLELVLEVFAVLLKTLESPESSPMVLKKAFQATLRWLQNPHKTPSSSDL
  SSDALLFLGELFPILQKRLCSPCWEVRDSALEFLTHLIRHWGGQADFREALRSSEVPTLALQLLQDPESY
  VRASAVGAAGQLSSQGLQAAPASPENSQAQQVDTGSW
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 141.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 231841
• UniProt ID: Q8C3R1
• Cytogenetics: 5 G2
• Refseq Size: 3856
• Refseq ORF: 1791
• Synonyms: AA881470; Brat1
• Summary: A similar gene in human encodes a Breast Cancer 1 (BRCA1) interacting protein that is involved in cell cycle checkpoint signaling. The similar human protein is localized to DNA double strand breaks caused by ionizing radiation, and regulates cellular DNA damage response through interactions with Ataxia Telangiectasia Mutated (ATM) and DNA-dependent Protein Kinase. A pseudogene of this gene is located on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]