Dcun1d4 (NM_001190734) Mouse Recombinant Protein
CAT#: TP522375
Purified recombinant protein of Mouse DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (Dcun1d4), transcript variant A, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (2)
Other products for "Dcun1d4"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR222375 representing NM_001190734
Red=Cloning site Green=Tags(s) MEFTQEQQACRPQRSEEMRHWKDFQLNSHLSTLASIHKIYHTLNKLNLTEDVGQDDHQTGSLRSCSSSDC FSKVMPPRKKRRPASGDDLSAKKSRHDSMYRKYESTRIKTEEEAFSSKRCLEWFYEYAGTEDAVGPEGME KFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRTTLDYLRSLLNDTTNFKLI YRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKDQWCNVLEFSRTISLDL SNYDEDGAWPVLLDEFVEWYKDKQMS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 36 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001177663 |
Locus ID | 100737 |
UniProt ID | Q8CCA0, Q8C5X2 |
Cytogenetics | 5 C3.3 |
Refseq Size | 4078 |
Refseq ORF | 918 |
Synonyms | AI836376 |
Summary | Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which are necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.