Fgf13 (NM_010200) Mouse Recombinant Protein

CAT#: TP521854

Purified recombinant protein of Mouse fibroblast growth factor 13 (Fgf13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR221854 representing NM_010200
  Red=Cloning site Green=Tags(s)
  
  MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIV
  TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSEHFTPE
  CKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLH
  DLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 28 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034330
• Locus ID: 14168
• UniProt ID: P70377
• Cytogenetics: X 33.31 cM
• Refseq Size: 2506
• Refseq ORF: 735
• Synonyms: Fhf2
• Summary: Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus.[UniProtKB/Swiss-Prot Function]