Myl1 (NM_021285) Mouse Recombinant Protein

CAT#: TP521651

Purified recombinant protein of Mouse myosin, light polypeptide 1 (Myl1), transcript variant 1f, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR221651 representing NM_021285
  Red=Cloning site Green=Tags(s)
  
  MAPKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEDFKEAFLLFDRTGECKITLSQVG
  DVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGT
  VMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEAFVKHIMSV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 20.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067260
• Locus ID: 17901
• UniProt ID: P05977, Q545T7
• Cytogenetics: 1 33.71 cM
• Refseq Size: 1003
• Refseq ORF: 564
• Synonyms: AI325107; D12Mgi4; MLC1; MLC1f; MLC3; MLC3f; Myl; Mylf
• Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two non-phosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]