Fam109a (NM_175474) Mouse Recombinant Protein

CAT#: TP521504

Purified recombinant protein of Mouse PH domain containing endocytic trafficking adaptor 1 (Pheta1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR221504 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLNERSLAFYATCDAPVDNAGFLYKRGGRGTGSHRRWFVLRGNILFYFEAEGSREPLGVILLEGCTVEL
  VDAREEFAFAVRFAGGRSRPYVLAADSQAALEGWVKALSRASFHYLRLVVRELEQQLAAMREGSPANALP
  ANPSPVLTQRPKENGWVVWSTLPEQPSVAPQRPPPLPPRRRASAANGPLASFAQLHARYGLEVQALRDQW
  RGGQAGLASLEVPWHPGSAETQTQDQPALRGHSGCKVLHVFRSVEWPVCNPGSQGT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_780683
• Locus ID: 231717
• UniProt ID: Q8BH49
• Cytogenetics: 5 F
• Refseq Size: 2335
• Refseq ORF: 801
• Synonyms: A230106M15Rik; AU017694; IPIP27A; Ses1
• Summary: Plays a role in endocytic trafficking. Required for receptor recycling from endosomes, both to the trans-Golgi network and the plasma membrane.[UniProtKB/Swiss-Prot Function]