Neil2 (NM_201610) Mouse Recombinant Protein
CAT#: TP520912
Purified recombinant protein of Mouse nei like 2 (E. coli) (Neil2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Neil2"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220912 representing NM_201610
Red=Cloning site Green=Tags(s) MPEGPSVRKFHHLVSPFVGQKVVKTGGSSKKLHPAAFQSLWLQDAQVHGKKLFLRFDPDEEMEPLNSSPQ PIQGMWQKEAVDRELALGPSAQEPSAGPSGSGEPVPSRSAETYNLGKIPSADAQRWLEVRFGLFGSIWVN DFSRAKKANKKGDWRDPVPRLVLHFSGGGFLVFYNCQMSWSPPPVIEPTCDILSEKFHRGQALEALSQAQ PVCYTLLDQRYFSGLGNIIKNEALYRARIHPLSLGSCLSSSSREALVDHVVEFSKDWLRDKFQGKERHTQ IYQKEQCPSGHQVMKETFGPPDGLQRLTWWCPQCQPQLSSKGPQNLPSS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 36.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_963904 |
Locus ID | 382913 |
UniProt ID | Q6R2P8, Q1LZM6 |
Cytogenetics | 14 D1 |
Refseq Size | 1914 |
Refseq ORF | 987 |
Synonyms | Gm1212; NEH2 |
Summary | Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double-stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.