Rsc1a1 (NM_023544) Mouse Recombinant Protein

CAT#: TP519633

Purified recombinant protein of Mouse regulatory solute carrier protein, family 1, member 1 (Rsc1a1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219633 representing NM_023544
  Red=Cloning site Green=Tags(s)
  
  MSSLPTSDGFDHPAPSGQSPEVGSPTSLARSVSASVCAIKPGDPNSIESLAMEATKASAEFQTNSKKTDP
  PPLQVLPDLASSAEQSLAMPFHKSSKEAVVAGNLEKSVEKGTQGLRVYLHTRQDASLTLTTTGMREPQIF
  AEEKSWHPENQTPSPVNGLQQHRETGSVQREAGQQSVPQDQGCLCDAEDLELHEEVVSLEALRKGELQRH
  AHLPSAEKGLPASGLCSCPCSEALMEVDTAEQSLVAMCSSTGRQDAVIKSPSVAHLASDNPTMEVETLQS
  NPSCEPVEHSILTRELQLPEDNVDMSTMDNKDDNSSSLLSGHGQPSVESAEEFCSSVTVALKELHELLVI
  SCKPASEESPEHVTCQSEIGAESQPSVSDLSGRRVQSVHLTPSDQYSQGSCHQATSESGKTEIVGTAPCA
  AVEDEASTSFEGLGDGLSPDREDVRRSTESARKSCSVAITSAKLSEQLPCTSGVEIAPELAASEGAHSQP
  SEHVHNPGPDRPETSSVCPGAGLPRSGLDQPPTQSLSTPSVLPPFIFPAADVDRILGAGFTLQEALGALH
  RVGGNADLALLVLLAKNIVVPT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 61.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_076033
• Locus ID: 69994
• UniProt ID: Q9ER99
• Cytogenetics: 4 D3
• Refseq Size: 2154
• Refseq ORF: 1746
• Synonyms: 1700027M01Rik; OTTMUSG00000010365; Rs1
• Summary: Mediates transcriptional and post-transcriptional regulation of SLC5A1. Inhibits a dynamin and PKC-dependent exocytotic pathway of SLC5A1. Also involved in transcriptional regulation of SLC22A2. Exhibits glucose-dependent, short-term inhibition of SLC5A1 and SLC22A2 by inhibiting the release of vesicles from the trans-Golgi network (By similarity). Regulates the expression of SLC5A1 in a tissue-specific manner and is specifically involved in its regulation in the small intestine.[UniProtKB/Swiss-Prot Function]