Slc30a10 (NM_001033286) Mouse Recombinant Protein
CAT#: TP519373
Purified recombinant protein of Mouse solute carrier family 30, member 10 (Slc30a10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Slc30a10"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR219373 representing NM_001033286
Red=Cloning site Green=Tags(s) MGRYSGKTCRLLFMLVLTAAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLGSGYIARRGPRGSSA TYGYVRAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVGALGLAVNVVGLLIFQDCGAC FSRCTRGRRTRPSQQPSQGDPRGALGCPQEAATATAPGSGTAVTLRGSSAGRKQQEGATVFSNVAGDSLN TENEPEETTKKEKKSEALNIRGVLLHVMGDALGSVVVVITAIIFYVQPLRREDPCNWQCYIDPSLTVVMV IIILSSAFPLIKETAVILLQMVPKGVNMEELMSQLSTVPGISSVHEVHIWELISGKIIATLHIKHQKGTE YQDASRKIREIFHHAGIHNVTIQFETLDLKEALEQKDFLLTCSAPCITQSCAKKLCCPPGTLPLALVNGC AEHNGRSSRESYRSIEAPEVAIDVDGCPREQGQTLSKTQERQHYENSTHF myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 51.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028458 |
Locus ID | 226781 |
UniProt ID | Q3UVU3 |
Cytogenetics | 1 H5 |
Refseq Size | 5836 |
Refseq ORF | 1410 |
Synonyms | E130106K10Rik; Gm212 |
Summary | Plays a pivotal role in manganese transport. Manganese is an essential cation for the function of several enzymes, including some crucially important for the metabolism of neurotransmitters and other neuronal metabolic pathways. However, elevated levels of manganese are cytotoxic and induce oxidative stress, mitochondrial dysfunction and apoptosis. Acts as manganese efflux transporter and confers protection against manganese-induced cell death. Also acts as zinc transporter involved in zinc homeostasis. Seems to mediate zinc transport into early endosomes and recycling endosomes to prevent zinc toxicity; the function may be regulated by heterodimerization with other zinc transporters of the SLC30A subfamily. The SLC30A3:SLC30A10 heterodimer is involved in zinc transport-dependent regulation of the EGFR/ERK transduction pathway in endosomes. May be involved in regulation of zinc-dependent senescence of vascular smooth muscle cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.